MAN1B1 monoclonal antibody (M01), clone 6B1 View larger

MAN1B1 monoclonal antibody (M01), clone 6B1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MAN1B1 monoclonal antibody (M01), clone 6B1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,S-ELISA,ELISA,WB-Re

More info about MAN1B1 monoclonal antibody (M01), clone 6B1

Brand: Abnova
Reference: H00011253-M01
Product name: MAN1B1 monoclonal antibody (M01), clone 6B1
Product description: Mouse monoclonal antibody raised against a partial recombinant MAN1B1.
Clone: 6B1
Isotype: IgG2a Kappa
Gene id: 11253
Gene name: MAN1B1
Gene alias: MANA-ER
Gene description: mannosidase, alpha, class 1B, member 1
Genbank accession: NM_016219
Immunogen: MAN1B1 (NP_057303, 112 a.a. ~ 211 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: AFRLEEEQKMRPEIAGLKPANPPVLPAPQKADTDPENLPEISSQKTQRHIQRGPPHLQIRPPSQDLKDGTQEEATKRQEAPVDPRPEGDPQRTVISWRGA
Protein accession: NP_057303
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00011253-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00011253-M01-3-4-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to MAN1B1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3 ug/ml]
Applications: WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MAN1B1 monoclonal antibody (M01), clone 6B1 now

Add to cart