PACSIN2 monoclonal antibody (M05), clone 3D6 View larger

PACSIN2 monoclonal antibody (M05), clone 3D6

H00011252-M05_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PACSIN2 monoclonal antibody (M05), clone 3D6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,IF,S-ELISA,ELISA,WB-Re

More info about PACSIN2 monoclonal antibody (M05), clone 3D6

Brand: Abnova
Reference: H00011252-M05
Product name: PACSIN2 monoclonal antibody (M05), clone 3D6
Product description: Mouse monoclonal antibody raised against a partial recombinant PACSIN2.
Clone: 3D6
Isotype: IgG2a Kappa
Gene id: 11252
Gene name: PACSIN2
Gene alias: SDPII
Gene description: protein kinase C and casein kinase substrate in neurons 2
Genbank accession: NM_007229
Immunogen: PACSIN2 (NP_009160.1, 368 a.a. ~ 428 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DDTGSTVSEKEDIKAKNVSSYEKTQSYPTDWSDDESNNPFSSTDANGDSNPFDDDATSGTE
Protein accession: NP_009160.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00011252-M05-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (32.45 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00011252-M05-3-2-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to PACSIN2 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml]
Applications: IHC-P,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PACSIN2 monoclonal antibody (M05), clone 3D6 now

Add to cart