Brand: | Abnova |
Reference: | H00011238-M06 |
Product name: | CA5B monoclonal antibody (M06), clone 1E12 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant CA5B. |
Clone: | 1E12 |
Isotype: | IgG1 Kappa |
Gene id: | 11238 |
Gene name: | CA5B |
Gene alias: | CA-VB|MGC39962 |
Gene description: | carbonic anhydrase VB, mitochondrial |
Genbank accession: | BC028142 |
Immunogen: | CA5B (AAH28142, 1 a.a. ~ 317 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MVVMNSLRVILQASPGKLLWRKFQIPRFMPARPCSLYTCTYKTRNRALHPLWESVDLVPGGDRQSPINIRWRDSVYDPGLKPLTISYDPATCLHVWNNGYSFLVEFEDSTDKSVIKGGPLEHNYRLKQFHFHWGAIDAWGSEHTVDSKCFPAELHLVHWNAVRFENFEDAALEENGLAVIGVFLKLGKHHKELQKLVDTLPSIKHKDALVEFGSFDPSCLMPTCPDYWTYSGSLTTPPLSESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVDNFRPLQPLMNRTVRSSFRHDYVLNVQAKPKPATSQATP |
Protein accession: | AAH28142 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged CA5B is 0.1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |