Brand: | Abnova |
Reference: | H00011228-M01 |
Product name: | RASSF8 monoclonal antibody (M01), clone 2G1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RASSF8. |
Clone: | 2G1 |
Isotype: | IgG2a Kappa |
Gene id: | 11228 |
Gene name: | RASSF8 |
Gene alias: | C12orf2|HoJ-1 |
Gene description: | Ras association (RalGDS/AF-6) domain family (N-terminal) member 8 |
Genbank accession: | NM_007211 |
Immunogen: | RASSF8 (NP_009142, 40 a.a. ~ 137 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | YTLIEKWRDTERHLAPHENPIISLNKWGQYASDVQLILRRTGPSLSERPTSDSVARIPERTLYRQSLPPLAKLRPQIDKSIKRREPKRKSLTFTGGAK |
Protein accession: | NP_009142 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to RASSF8 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml] |
Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,IP |
Shipping condition: | Dry Ice |