Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of AKAP10 monoclonal antibody (M04), clone 8C10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
More info about AKAP10 monoclonal antibody (M04), clone 8C10
| Brand: | Abnova |
| Reference: | H00011216-M04 |
| Product name: | AKAP10 monoclonal antibody (M04), clone 8C10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant AKAP10. |
| Clone: | 8C10 |
| Isotype: | IgG2a Kappa |
| Gene id: | 11216 |
| Gene name: | AKAP10 |
| Gene alias: | D-AKAP2|MGC9414|PRKA10 |
| Gene description: | A kinase (PRKA) anchor protein 10 |
| Genbank accession: | NM_007202 |
| Immunogen: | AKAP10 (NP_009133, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MRGAGPSPRQSPRTLRPDPGPAMSFFRRKVKGKEQEKTSDVKSIKASISVHSPQKSTKNHALLEAAGPSHVAINAISANMDSFSSSRTATLKKQPSHMEA |
| Protein accession: | NP_009133 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to AKAP10 on formalin-fixed paraffin-embedded human testis. [antibody concentration 0.5 ug/ml] |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
| Shipping condition: | Dry Ice |
| Publications: | D-AKAP2 interacts with Rab4 and Rab11 through its RGS domains and regulates transferrin receptor recycling.Eggers CT, Schafer JC, Goldenring JR, Taylor SS. J Biol Chem. 2009 Nov 20;284(47):32869-80. Epub 2009 Sep 21. |