PROSC monoclonal antibody (M02), clone 2G1 View larger

PROSC monoclonal antibody (M02), clone 2G1

H00011212-M02_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PROSC monoclonal antibody (M02), clone 2G1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about PROSC monoclonal antibody (M02), clone 2G1

Brand: Abnova
Reference: H00011212-M02
Product name: PROSC monoclonal antibody (M02), clone 2G1
Product description: Mouse monoclonal antibody raised against a partial recombinant PROSC.
Clone: 2G1
Isotype: IgG2b Kappa
Gene id: 11212
Gene name: PROSC
Gene alias: FLJ11861
Gene description: proline synthetase co-transcribed homolog (bacterial)
Genbank accession: NM_007198
Immunogen: PROSC (NP_009129.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MWRAGSMSAELGVGCALRAVNERVQQAVARRPRDLPAIQPRLVAVSKTKPADMVIEAYGHGQRTFGENYVQELLEKASNPKILSLCPEIKWHFIGHLQKQ
Protein accession: NP_009129.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00011212-M02-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged PROSC is 3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy PROSC monoclonal antibody (M02), clone 2G1 now

Add to cart