KLK8 monoclonal antibody (M01), clone 2F11 View larger

KLK8 monoclonal antibody (M01), clone 2F11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of KLK8 monoclonal antibody (M01), clone 2F11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re

More info about KLK8 monoclonal antibody (M01), clone 2F11

Brand: Abnova
Reference: H00011202-M01
Product name: KLK8 monoclonal antibody (M01), clone 2F11
Product description: Mouse monoclonal antibody raised against a partial recombinant KLK8.
Clone: 2F11
Isotype: IgG2a Kappa
Gene id: 11202
Gene name: KLK8
Gene alias: HNP|NP|NRPN|PRSS19|TADG14
Gene description: kallikrein-related peptidase 8
Genbank accession: NM_007196
Immunogen: KLK8 (NP_009127, 97 a.a. ~ 204 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EIPVVQSIPHPCYNSSDVEDHNHDLMLLQLRDQASLGSKVKPISLADHCTQPGQKCTVSGWGTVTSPRENFPDTLNCAEVKIFPQKKCEDAYPGQITDGMVCAGSSKG
Protein accession: NP_009127
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00011202-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.62 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00011202-M01-1-4-1.jpg
Application image note: KLK8 monoclonal antibody (M01), clone 2F11 Western Blot analysis of KLK8 expression in A-431 ( Cat # L015V1 ).
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy KLK8 monoclonal antibody (M01), clone 2F11 now

Add to cart