POLI monoclonal antibody (M01A), clone 8G9 View larger

POLI monoclonal antibody (M01A), clone 8G9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of POLI monoclonal antibody (M01A), clone 8G9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about POLI monoclonal antibody (M01A), clone 8G9

Brand: Abnova
Reference: H00011201-M01A
Product name: POLI monoclonal antibody (M01A), clone 8G9
Product description: Mouse monoclonal antibody raised against a partial recombinant POLI.
Clone: 8G9
Isotype: IgG3 Kappa
Gene id: 11201
Gene name: POLI
Gene alias: RAD30B|RAD3OB
Gene description: polymerase (DNA directed) iota
Genbank accession: BC032662
Immunogen: POLI (AAH32662, 616 a.a. ~ 715 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PQGFHFTNSNPAVSAFHSFPNLQSEQLFSRNHTTDSHKQTVATDSHEGLTENREPDSVDEKITFPSDIDPQVFYELPEAVQKELLAEWKRAGSDFHIGHK
Protein accession: AAH32662
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00011201-M01A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00011201-M01A-13-15-1.jpg
Application image note: Western Blot analysis of POLI expression in transfected 293T cell line by POLI monoclonal antibody (M01A), clone 8G9.

Lane 1: POLI transfected lysate(80.3 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy POLI monoclonal antibody (M01A), clone 8G9 now

Add to cart