Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00011201-M01A |
Product name: | POLI monoclonal antibody (M01A), clone 8G9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant POLI. |
Clone: | 8G9 |
Isotype: | IgG3 Kappa |
Gene id: | 11201 |
Gene name: | POLI |
Gene alias: | RAD30B|RAD3OB |
Gene description: | polymerase (DNA directed) iota |
Genbank accession: | BC032662 |
Immunogen: | POLI (AAH32662, 616 a.a. ~ 715 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PQGFHFTNSNPAVSAFHSFPNLQSEQLFSRNHTTDSHKQTVATDSHEGLTENREPDSVDEKITFPSDIDPQVFYELPEAVQKELLAEWKRAGSDFHIGHK |
Protein accession: | AAH32662 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of POLI expression in transfected 293T cell line by POLI monoclonal antibody (M01A), clone 8G9. Lane 1: POLI transfected lysate(80.3 KDa). Lane 2: Non-transfected lysate. |
Applications: | ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |