Brand: | Abnova |
Reference: | H00011200-M02A |
Product name: | CHEK2 monoclonal antibody (M02A), clone 6B8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CHEK2. |
Clone: | 6B8 |
Isotype: | IgG1 Kappa |
Gene id: | 11200 |
Gene name: | CHEK2 |
Gene alias: | CDS1|CHK2|HuCds1|LFS2|PP1425|RAD53 |
Gene description: | CHK2 checkpoint homolog (S. pombe) |
Genbank accession: | BC004207 |
Immunogen: | CHEK2 (AAH04207, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSRESDVEAQQSHGSSACSQPHGSVTQSQGSSSQSQGISSSSTSTMPNSSQSSHSSSGTLSSLETVSTQELYSIPEDQEPEDQEPEEPTPAPWARLWALQ |
Protein accession: | AAH04207 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.41 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | CHEK2 monoclonal antibody (M02A), clone 6B8 Western Blot analysis of CHEK2 expression in Jurkat ( Cat # L017V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |