CHEK2 monoclonal antibody (M02), clone 6B8 View larger

CHEK2 monoclonal antibody (M02), clone 6B8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CHEK2 monoclonal antibody (M02), clone 6B8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about CHEK2 monoclonal antibody (M02), clone 6B8

Brand: Abnova
Reference: H00011200-M02
Product name: CHEK2 monoclonal antibody (M02), clone 6B8
Product description: Mouse monoclonal antibody raised against a partial recombinant CHEK2.
Clone: 6B8
Isotype: IgG1 Kappa
Gene id: 11200
Gene name: CHEK2
Gene alias: CDS1|CHK2|HuCds1|LFS2|PP1425|RAD53
Gene description: CHK2 checkpoint homolog (S. pombe)
Genbank accession: BC004207
Immunogen: CHEK2 (AAH04207, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MSRESDVEAQQSHGSSACSQPHGSVTQSQGSSSQSQGISSSSTSTMPNSSQSSHSSSGTLSSLETVSTQELYSIPEDQEPEDQEPEEPTPAPWARLWALQ
Protein accession: AAH04207
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00011200-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.41 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00011200-M02-1-6-1.jpg
Application image note: CHEK2 monoclonal antibody (M02), clone 6B8 Western Blot analysis of CHEK2 expression in Jurkat ( Cat # L017V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CHEK2 monoclonal antibody (M02), clone 6B8 now

Add to cart