SUPT16H monoclonal antibody (M01), clone 1D12 View larger

SUPT16H monoclonal antibody (M01), clone 1D12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SUPT16H monoclonal antibody (M01), clone 1D12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about SUPT16H monoclonal antibody (M01), clone 1D12

Brand: Abnova
Reference: H00011198-M01
Product name: SUPT16H monoclonal antibody (M01), clone 1D12
Product description: Mouse monoclonal antibody raised against a partial recombinant SUPT16H.
Clone: 1D12
Isotype: IgG2a Kappa
Gene id: 11198
Gene name: SUPT16H
Gene alias: CDC68|FACT|FACTP140|FLJ10857|FLJ14010|FLJ34357|SPT16/CDC68
Gene description: suppressor of Ty 16 homolog (S. cerevisiae)
Genbank accession: NM_007192
Immunogen: SUPT16H (NP_009123, 608 a.a. ~ 715 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PGEQTVPALNLQNAFRIIKEVQKRYKTREAEEKEKEGIVKQDSLVINLNRSNPKLKDLYIRPNIAQKRMQGSLEAHVNGFRFTSVRGDKVDILYNNIKHALFQPCDGE
Protein accession: NP_009123
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00011198-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.62 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00011198-M01-1-25-1.jpg
Application image note: SUPT16H monoclonal antibody (M01), clone 1D12 Western Blot analysis of SUPT16H expression in Hela S3 NE ( Cat # L013V3 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SUPT16H monoclonal antibody (M01), clone 1D12 now

Add to cart