CEP250 monoclonal antibody (M02), clone 4A1 View larger

CEP250 monoclonal antibody (M02), clone 4A1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CEP250 monoclonal antibody (M02), clone 4A1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about CEP250 monoclonal antibody (M02), clone 4A1

Brand: Abnova
Reference: H00011190-M02
Product name: CEP250 monoclonal antibody (M02), clone 4A1
Product description: Mouse monoclonal antibody raised against a partial recombinant CEP250.
Clone: 4A1
Isotype: IgG2a Kappa
Gene id: 11190
Gene name: CEP250
Gene alias: C-NAP1|CEP2|CNAP1|MGC88542
Gene description: centrosomal protein 250kDa
Genbank accession: BC001433
Immunogen: CEP250 (AAH01433, 141 a.a. ~ 240 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LTVDWSRARDELMRKESQWQMEQEFFKGYLKGEHGRLLSLWREVVTFRRHFLEMKSATDRDLMELKAEHVRLSGSLLTCCLRLTVGAQSREPNGSGRMDG
Protein accession: AAH01433
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00011190-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CEP250 monoclonal antibody (M02), clone 4A1 now

Add to cart