Brand: | Abnova |
Reference: | H00011190-M02 |
Product name: | CEP250 monoclonal antibody (M02), clone 4A1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CEP250. |
Clone: | 4A1 |
Isotype: | IgG2a Kappa |
Gene id: | 11190 |
Gene name: | CEP250 |
Gene alias: | C-NAP1|CEP2|CNAP1|MGC88542 |
Gene description: | centrosomal protein 250kDa |
Genbank accession: | BC001433 |
Immunogen: | CEP250 (AAH01433, 141 a.a. ~ 240 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LTVDWSRARDELMRKESQWQMEQEFFKGYLKGEHGRLLSLWREVVTFRRHFLEMKSATDRDLMELKAEHVRLSGSLLTCCLRLTVGAQSREPNGSGRMDG |
Protein accession: | AAH01433 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |