NISCH monoclonal antibody (M02), clone 2C8 View larger

NISCH monoclonal antibody (M02), clone 2C8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NISCH monoclonal antibody (M02), clone 2C8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about NISCH monoclonal antibody (M02), clone 2C8

Brand: Abnova
Reference: H00011188-M02
Product name: NISCH monoclonal antibody (M02), clone 2C8
Product description: Mouse monoclonal antibody raised against a partial recombinant NISCH.
Clone: 2C8
Isotype: IgG1 Kappa
Gene id: 11188
Gene name: NISCH
Gene alias: FLJ14425|FLJ40413|FLJ90519|I-1|IRAS|KIAA0975
Gene description: nischarin
Genbank accession: BC056900
Immunogen: NISCH (AAH56900, 1246 a.a. ~ 1345 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LTGSTPMQVVTCLTRDSYLTHCFLQHLMVVLSSLERTPSPEPVDKDFYSEFGNKTTGKMENYELIHSSRVKFTYPSEEEIGDLTFTVAQKMAEPEKAPAL
Protein accession: AAH56900
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00011188-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00011188-M02-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged NISCH is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy NISCH monoclonal antibody (M02), clone 2C8 now

Add to cart