MAP4K1 monoclonal antibody (M02), clone 1G6 View larger

MAP4K1 monoclonal antibody (M02), clone 1G6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MAP4K1 monoclonal antibody (M02), clone 1G6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about MAP4K1 monoclonal antibody (M02), clone 1G6

Brand: Abnova
Reference: H00011184-M02
Product name: MAP4K1 monoclonal antibody (M02), clone 1G6
Product description: Mouse monoclonal antibody raised against a partial recombinant MAP4K1.
Clone: 1G6
Isotype: IgG1 Kappa
Gene id: 11184
Gene name: MAP4K1
Gene alias: HPK1
Gene description: mitogen-activated protein kinase kinase kinase kinase 1
Genbank accession: NM_007181
Immunogen: MAP4K1 (NP_009112, 278 a.a. ~ 377 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GLNRGLILDLLDKLKNPGKGPSIGDIEDEEPELPPAIPRRIRSTHRSSSLGIPDADCCRRHMEFRKLRGMETRPPANTARLQPPRDLRSSSPRKQLSESS
Protein accession: NP_009112
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00011184-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00011184-M02-1-6-1.jpg
Application image note: MAP4K1 monoclonal antibody (M02), clone 1G6. Western Blot analysis of MAP4K1 expression in Jurkat.
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MAP4K1 monoclonal antibody (M02), clone 1G6 now

Add to cart