TREH monoclonal antibody (M02), clone 2D10 View larger

TREH monoclonal antibody (M02), clone 2D10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TREH monoclonal antibody (M02), clone 2D10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about TREH monoclonal antibody (M02), clone 2D10

Brand: Abnova
Reference: H00011181-M02
Product name: TREH monoclonal antibody (M02), clone 2D10
Product description: Mouse monoclonal antibody raised against a partial recombinant TREH.
Clone: 2D10
Isotype: IgG2a Kappa
Gene id: 11181
Gene name: TREH
Gene alias: MGC129621|TRE|TREA
Gene description: trehalase (brush-border membrane glycoprotein)
Genbank accession: NM_007180
Immunogen: TREH (NP_009111.1, 25 a.a. ~ 124 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PPPCESEIYCHGELLNQVQMAKLYQDDKQFVDMPLSIAPEQVLQTFTELSRDHNHSIPREQLQAFVHEHFQAKGQELQPWTPADWKDSPQFLQKISDAKL
Protein accession: NP_009111.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00011181-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00011181-M02-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged TREH is 0.1 ng/ml as a capture antibody.
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TREH monoclonal antibody (M02), clone 2D10 now

Add to cart