ZNF277 monoclonal antibody (M01), clone 1B2 View larger

ZNF277 monoclonal antibody (M01), clone 1B2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZNF277 monoclonal antibody (M01), clone 1B2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab

More info about ZNF277 monoclonal antibody (M01), clone 1B2

Brand: Abnova
Reference: H00011179-M01
Product name: ZNF277 monoclonal antibody (M01), clone 1B2
Product description: Mouse monoclonal antibody raised against a full length recombinant ZNF277.
Clone: 1B2
Isotype: IgG1 kappa
Gene id: 11179
Gene name: ZNF277
Gene alias: NRIF4|ZNF277P
Gene description: zinc finger protein 277
Genbank accession: BC020626
Immunogen: ZNF277 (AAH20626, 1 a.a. ~ 278 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MQEDRDGSCSTVGGVGYGDSKDCILEPLSLPESPGGTTTLEGSPSVPCIFCEEHFPVAEQDKLLKHMIIEHKIVIADVKLVADFQRYILYWRKRFTEQPITDFCSVIRINSTAPFEEQENYFLLCDVLPEDRILREELQKQRLREILEQQQQERNDTNFHGVCMFCNEEFLGNRSVILNHMAREHAFNIGLPDNIVNCNEFLCTLQKKLDNLQCLYCEKTFRDKNTLKDHMRKKQHRKINPKNREYDRFYVINYLVRLSFHNLKFDCSTANKIFLRTN
Protein accession: AAH20626
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00011179-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (56.32 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00011179-M01-1-6-1.jpg
Application image note: ZNF277 monoclonal antibody (M01), clone 1B2 Western Blot analysis of ZNF277 expression in Jurkat ( Cat # L017V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab
Shipping condition: Dry Ice

Reviews

Buy ZNF277 monoclonal antibody (M01), clone 1B2 now

Add to cart