Brand: | Abnova |
Reference: | H00011179-M01 |
Product name: | ZNF277 monoclonal antibody (M01), clone 1B2 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant ZNF277. |
Clone: | 1B2 |
Isotype: | IgG1 kappa |
Gene id: | 11179 |
Gene name: | ZNF277 |
Gene alias: | NRIF4|ZNF277P |
Gene description: | zinc finger protein 277 |
Genbank accession: | BC020626 |
Immunogen: | ZNF277 (AAH20626, 1 a.a. ~ 278 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MQEDRDGSCSTVGGVGYGDSKDCILEPLSLPESPGGTTTLEGSPSVPCIFCEEHFPVAEQDKLLKHMIIEHKIVIADVKLVADFQRYILYWRKRFTEQPITDFCSVIRINSTAPFEEQENYFLLCDVLPEDRILREELQKQRLREILEQQQQERNDTNFHGVCMFCNEEFLGNRSVILNHMAREHAFNIGLPDNIVNCNEFLCTLQKKLDNLQCLYCEKTFRDKNTLKDHMRKKQHRKINPKNREYDRFYVINYLVRLSFHNLKFDCSTANKIFLRTN |
Protein accession: | AAH20626 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (56.32 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | ZNF277 monoclonal antibody (M01), clone 1B2 Western Blot analysis of ZNF277 expression in Jurkat ( Cat # L017V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
Shipping condition: | Dry Ice |