Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of LZTS1 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about LZTS1 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00011178-A01 |
| Product name: | LZTS1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant LZTS1. |
| Gene id: | 11178 |
| Gene name: | LZTS1 |
| Gene alias: | F37|FEZ1 |
| Gene description: | leucine zipper, putative tumor suppressor 1 |
| Genbank accession: | NM_021020 |
| Immunogen: | LZTS1 (NP_066300, 514 a.a. ~ 596 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | ERQGHDQMSSGFQHERLVWKEEKEKVIQYQKQLQQSYVAMYQRNQRLEKALQQLARGDSAGEPLEVDLEGADIPYEDIIATEI |
| Protein accession: | NP_066300 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.24 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | LZTS1 polyclonal antibody (A01), Lot # 051108JC01 Western Blot analysis of LZTS1 expression in SJCRH30 ( Cat # L027V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | MicroRNA-135b promotes lung cancer metastasis by regulating multiple targets in the Hippo pathway and LZTS1.Lin CW, Chang YL, Chang YC, Lin JC, Chen CC, Pan SH, Wu CT, Chen HY, Yang SC, Hong TM, Yang PC Nat Commun. 2013;4:1877. doi: 10.1038/ncomms2876. |