Brand: | Abnova |
Reference: | H00011177-A01 |
Product name: | BAZ1A polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant BAZ1A. |
Gene id: | 11177 |
Gene name: | BAZ1A |
Gene alias: | ACF1|DKFZp586E0518|FLJ14383|WALp1|WCRF180|hACF1 |
Gene description: | bromodomain adjacent to zinc finger domain, 1A |
Genbank accession: | NM_013448 |
Immunogen: | BAZ1A (NP_038476, 1457 a.a. ~ 1556 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | LVSKIQVPDYYDIIKKPIALNIIREKVNKCEYKLASEFIDDIELMFSNCFEYNPRNTSEAKAGTRLQAFFHIQAQKLGLHVTPSNVDQVSTPPAAKKSRI |
Protein accession: | NP_038476 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |