FAM107A purified MaxPab mouse polyclonal antibody (B01P) View larger

FAM107A purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FAM107A purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about FAM107A purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00011170-B01P
Product name: FAM107A purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human FAM107A protein.
Gene id: 11170
Gene name: FAM107A
Gene alias: DRR1|FLJ30158|FLJ45473|TU3A
Gene description: family with sequence similarity 107, member A
Genbank accession: NM_007177.1
Immunogen: FAM107A (NP_009108.1, 1 a.a. ~ 144 a.a) full-length human protein.
Immunogen sequence/protein sequence: MYSEIQRERADIGGLMARPEYREWNPELIKPKKLLNPVKASRSHQELHRELLMNHRRGLGVDSKPELQRVLEHRRRNQLIKKKKEELEAKRLQCPFEQELLRRQQRLNQLEKPPEKEEDHAPEFIKVRENLRRIATLTSEEREL
Protein accession: NP_009108.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00011170-B01P-13-15-1.jpg
Application image note: Western Blot analysis of FAM107A expression in transfected 293T cell line (H00011170-T01) by FAM107A MaxPab polyclonal antibody.

Lane 1: FAM107A transfected lysate(15.84 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy FAM107A purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart