Brand: | Abnova |
Reference: | H00011169-Q01 |
Product name: | WDHD1 (Human) Recombinant Protein (Q01) |
Product description: | Human WDHD1 partial ORF ( NP_009017, 1031 a.a. - 1128 a.a.) recombinant protein with GST-tag at N-terminal. |
Gene id: | 11169 |
Gene name: | WDHD1 |
Gene alias: | AND-1 |
Gene description: | WD repeat and HMG-box DNA binding protein 1 |
Genbank accession: | NM_007086 |
Immunogen sequence/protein sequence: | SNILSDNPDFSDEADIIKEGMIRFRVLSTEERKVWANKAKGETASEGTEAKKRKRVVDESDETENQEEKAKENLNLSKKQKPLDFSTNQKLSAFAFKQ |
Protein accession: | NP_009017 |
Preparation method: | in vitro wheat germ expression system |
Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Quality control testing picture: |  |
Note: | Best use within three months from the date of receipt of this protein. |
Tag: | GST |
Product type: | Proteins |
Host species: | Wheat Germ (in vitro) |
Antigen species / target species: | Human |
Applications: | AP,Array,ELISA,WB-Re |
Shipping condition: | Dry Ice |