Brand: | Abnova |
Reference: | H00011169-M01 |
Product name: | WDHD1 monoclonal antibody (M01), clone 2F10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant WDHD1. |
Clone: | 2F10 |
Isotype: | IgG1 Kappa |
Gene id: | 11169 |
Gene name: | WDHD1 |
Gene alias: | AND-1 |
Gene description: | WD repeat and HMG-box DNA binding protein 1 |
Genbank accession: | NM_007086 |
Immunogen: | WDHD1 (NP_009017, 1031 a.a. ~ 1128 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SNILSDNPDFSDEADIIKEGMIRFRVLSTEERKVWANKAKGETASEGTEAKKRKRVVDESDETENQEEKAKENLNLSKKQKPLDFSTNQKLSAFAFKQ |
Protein accession: | NP_009017 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged WDHD1 is 0.03 ng/ml as a capture antibody. |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |