WDHD1 monoclonal antibody (M01), clone 2F10 View larger

WDHD1 monoclonal antibody (M01), clone 2F10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of WDHD1 monoclonal antibody (M01), clone 2F10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr

More info about WDHD1 monoclonal antibody (M01), clone 2F10

Brand: Abnova
Reference: H00011169-M01
Product name: WDHD1 monoclonal antibody (M01), clone 2F10
Product description: Mouse monoclonal antibody raised against a partial recombinant WDHD1.
Clone: 2F10
Isotype: IgG1 Kappa
Gene id: 11169
Gene name: WDHD1
Gene alias: AND-1
Gene description: WD repeat and HMG-box DNA binding protein 1
Genbank accession: NM_007086
Immunogen: WDHD1 (NP_009017, 1031 a.a. ~ 1128 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SNILSDNPDFSDEADIIKEGMIRFRVLSTEERKVWANKAKGETASEGTEAKKRKRVVDESDETENQEEKAKENLNLSKKQKPLDFSTNQKLSAFAFKQ
Protein accession: NP_009017
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00011169-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.52 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00011169-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged WDHD1 is 0.03 ng/ml as a capture antibody.
Applications: WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy WDHD1 monoclonal antibody (M01), clone 2F10 now

Add to cart