PSIP1 monoclonal antibody (M02), clone 1C4 View larger

PSIP1 monoclonal antibody (M02), clone 1C4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PSIP1 monoclonal antibody (M02), clone 1C4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,WB-Ti,IF,ELISA,WB-Re

More info about PSIP1 monoclonal antibody (M02), clone 1C4

Brand: Abnova
Reference: H00011168-M02
Product name: PSIP1 monoclonal antibody (M02), clone 1C4
Product description: Mouse monoclonal antibody raised against a full-length recombinant PSIP1.
Clone: 1C4
Isotype: IgG1 Kappa
Gene id: 11168
Gene name: PSIP1
Gene alias: DFS70|LEDGF|MGC74712|PAIP|PSIP2|p52|p75
Gene description: PC4 and SFRS1 interacting protein 1
Genbank accession: BC033817
Immunogen: PSIP1 (AAH33817, 1 a.a. ~ 50 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MTRDFKPGDLIFAKMKGYPHWPARVDEVPDGAVKPPTNKLPIFFFGTHET
Protein accession: AAH33817
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00011168-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (31.13 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00011168-M02-2-A0-1.jpg
Application image note: PSIP1 monoclonal antibody (M02), clone 1C4. Western Blot analysis of PSIP1 expression in human kidney.
Applications: WB-Ce,WB-Ti,IF,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PSIP1 monoclonal antibody (M02), clone 1C4 now

Add to cart