PSIP1 monoclonal antibody (M01), clone 3H1 View larger

PSIP1 monoclonal antibody (M01), clone 3H1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PSIP1 monoclonal antibody (M01), clone 3H1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,IHC-P,S-ELISA,ELISA,WB-Re

More info about PSIP1 monoclonal antibody (M01), clone 3H1

Brand: Abnova
Reference: H00011168-M01
Product name: PSIP1 monoclonal antibody (M01), clone 3H1
Product description: Mouse monoclonal antibody raised against a full length recombinant PSIP1.
Clone: 3H1
Isotype: IgG1 kappa
Gene id: 11168
Gene name: PSIP1
Gene alias: DFS70|LEDGF|MGC74712|PAIP|PSIP2|p52|p75
Gene description: PC4 and SFRS1 interacting protein 1
Genbank accession: BC033817
Immunogen: PSIP1 (AAH33817, 1 a.a. ~ 50 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MTRDFKPGDLIFAKMKGYPHWPARVDEVPDGAVKPPTNKLPIFFFGTHET
Protein accession: AAH33817
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00011168-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (31.13 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00011168-M01-3-12-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to PSIP1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]
Applications: WB-Ti,IHC-P,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: LEDGF/p75 functions downstream from preintegration complex formation to effect gene-specific HIV-1 integration.Shun MC, Raghavendra NK, Vandegraaff N, Daigle JE, Hughes S, Kellam P, Cherepanov P, Engelman A.
Genes Dev. 2007 Jul 15;21(14):1767-78.

Reviews

Buy PSIP1 monoclonal antibody (M01), clone 3H1 now

Add to cart