Brand: | Abnova |
Reference: | H00011168-M01 |
Product name: | PSIP1 monoclonal antibody (M01), clone 3H1 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant PSIP1. |
Clone: | 3H1 |
Isotype: | IgG1 kappa |
Gene id: | 11168 |
Gene name: | PSIP1 |
Gene alias: | DFS70|LEDGF|MGC74712|PAIP|PSIP2|p52|p75 |
Gene description: | PC4 and SFRS1 interacting protein 1 |
Genbank accession: | BC033817 |
Immunogen: | PSIP1 (AAH33817, 1 a.a. ~ 50 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MTRDFKPGDLIFAKMKGYPHWPARVDEVPDGAVKPPTNKLPIFFFGTHET |
Protein accession: | AAH33817 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (31.13 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to PSIP1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml] |
Applications: | WB-Ti,IHC-P,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | LEDGF/p75 functions downstream from preintegration complex formation to effect gene-specific HIV-1 integration.Shun MC, Raghavendra NK, Vandegraaff N, Daigle JE, Hughes S, Kellam P, Cherepanov P, Engelman A. Genes Dev. 2007 Jul 15;21(14):1767-78. |