SOX21 monoclonal antibody (M01), clone 2G10 View larger

SOX21 monoclonal antibody (M01), clone 2G10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SOX21 monoclonal antibody (M01), clone 2G10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about SOX21 monoclonal antibody (M01), clone 2G10

Brand: Abnova
Reference: H00011166-M01
Product name: SOX21 monoclonal antibody (M01), clone 2G10
Product description: Mouse monoclonal antibody raised against a partial recombinant SOX21.
Clone: 2G10
Isotype: IgG2a Kappa
Gene id: 11166
Gene name: SOX21
Gene alias: SOX25
Gene description: SRY (sex determining region Y)-box 21
Genbank accession: NM_007084
Immunogen: SOX21 (NP_009015, 224 a.a. ~ 265 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: HSHPSPGNPGYMIPCNCSAWPSPGLQPPLAYILLPGMGKPQL
Protein accession: NP_009015
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00011166-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (30.36 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00011166-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged SOX21 is approximately 0.03ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SOX21 monoclonal antibody (M01), clone 2G10 now

Add to cart