Brand: | Abnova |
Reference: | H00011164-M04 |
Product name: | NUDT5 monoclonal antibody (M04), clone 2A3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NUDT5. |
Clone: | 2A3 |
Isotype: | IgG1 Kappa |
Gene id: | 11164 |
Gene name: | NUDT5 |
Gene alias: | YSA1|YSA1H|hYSAH1 |
Gene description: | nudix (nucleoside diphosphate linked moiety X)-type motif 5 |
Genbank accession: | NM_014142 |
Immunogen: | NUDT5 (NP_054861, 120 a.a. ~ 219 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KGDIAECSPAVCMDPGLSNCTIHIVTVTINGDDAENARPKPKPGDGEFVEVISLPKNDLLQRLDALVAEEHLTVDARVYSYALALKHANAKPFEVPFLKF |
Protein accession: | NP_054861 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00011164-M04-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00011164-M04-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00011164-M04-42-R01V-1.jpg](http://www.abnova.com/application_image/H00011164-M04-42-R01V-1.jpg) |
Application image note: | Western blot analysis of NUDT5 over-expressed 293 cell line, cotransfected with NUDT5 Validated Chimera RNAi ( Cat # H00011164-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with NUDT5 monoclonal antibody (M04), clone 2A3 (Cat # H00011164-M04 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
Shipping condition: | Dry Ice |