Brand: | Abnova |
Reference: | H00011163-M08 |
Product name: | NUDT4 monoclonal antibody (M08), clone 2F2 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant NUDT4. |
Clone: | 2F2 |
Isotype: | IgG2a Kappa |
Gene id: | 11163 |
Gene name: | NUDT4 |
Gene alias: | DIPP2|DIPP2alpha|DIPP2beta|DKFZp686I1281|HDCMB47P|KIAA0487 |
Gene description: | nudix (nucleoside diphosphate linked moiety X)-type motif 4 |
Genbank accession: | BC012069 |
Immunogen: | NUDT4 (AAH12069, 1 a.a. ~ 181 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MMKFKPNQTRTYDREGFKKRAACLCFRSEQEDEVLLVSSSRYPDQWIVPGGGMEPEEEPGGAAVREVYEEAGVKGKLGRLLGIFEQNQDRKHRTYVYVLTVTEILEDWEDSVNIGRKREWFKVEDAIKVLQCHKPVHAEYLEKLKLGCSPANGNSTVPSLPDNNALFVTAAQTSGLPSSVR |
Protein accession: | AAH12069 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00011163-M08-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00011163-M08-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (45.65 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00011163-M08-9-18-1.jpg](http://www.abnova.com/application_image/H00011163-M08-9-18-1.jpg) |
Application image note: | Detection limit for recombinant GST tagged NUDT4 is approximately 3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |