H00011163-B01P_50ug
New product
Availability date:
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00011163-B01P |
Product name: | NUDT4 purified MaxPab mouse polyclonal antibody (B01P) |
Product description: | Mouse polyclonal antibody raised against a full-length human NUDT4 protein. |
Gene id: | 11163 |
Gene name: | NUDT4 |
Gene alias: | DIPP2|DIPP2alpha|DIPP2beta|DKFZp686I1281|HDCMB47P|KIAA0487 |
Gene description: | nudix (nucleoside diphosphate linked moiety X)-type motif 4 |
Genbank accession: | NM_019094.4 |
Immunogen: | NUDT4 (NP_061967.3, 1 a.a. ~ 180 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MMKFKPNQTRTYDREGFKKRAACLCFRSEQEDEVLLVSSSRYPDQWIVPGGGMEPEEEPGGAAVREVYEEAGVKGKLGRLLGIFENQDRKHRTYVYVLTVTEILEDWEDSVNIGRKREWFKVEDAIKVLQCHKPVHAEYLEKLKLGCSPANGNSTVPSLPDNNALFVTAAQTSGLPSSVR |
Protein accession: | NP_061967.3 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of NUDT4 expression in transfected 293T cell line (H00011163-T01) by NUDT4 MaxPab polyclonal antibody. Lane 1: NUDT4 transfected lysate(19.8 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |