RABL2B MaxPab mouse polyclonal antibody (B01) View larger

RABL2B MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RABL2B MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about RABL2B MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00011158-B01
Product name: RABL2B MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human RABL2B protein.
Gene id: 11158
Gene name: RABL2B
Gene alias: FLJ93981|FLJ98216
Gene description: RAB, member of RAS oncogene family-like 2B
Genbank accession: NM_001003789
Immunogen: RABL2B (NP_001003789, 1 a.a. ~ 229 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAEDKTKPSELDQGKYDADDNVKIICLGDSAVGKSKLMERFLMDGFQPQQLSTYALTLYKHTATVDGRTILVDFWDTAGQERFQSMHASYYHKAHACIMVFDVQRKVTYRNLSTWYTELREFRPEIPCIVVANKIDADINVTQKSFNFAKKFSLPLYFVSAADGTNVVKLFNDAIRLAVSYKQNSQDFMDEIFQELENFSLEQEEEDVPDQEQSSSIETPSEEAASPHS
Protein accession: NP_001003789
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00011158-B01-13-15-1.jpg
Application image note: Western Blot analysis of RABL2B expression in transfected 293T cell line (H00011158-T01) by RABL2B MaxPab polyclonal antibody.

Lane 1: RABL2B transfected lysate(25.19 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy RABL2B MaxPab mouse polyclonal antibody (B01) now

Add to cart