Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00011157-M01 |
Product name: | LSM6 monoclonal antibody (M01), clone 4B5-1B10 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant LSM6. |
Clone: | 4B5-1B10 |
Isotype: | IgG1 kappa |
Gene id: | 11157 |
Gene name: | LSM6 |
Gene alias: | YDR378C |
Gene description: | LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae) |
Genbank accession: | BC016026 |
Immunogen: | LSM6 (AAH16026, 1 a.a. ~ 80 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNVLYISTQKRRM |
Protein accession: | AAH16026 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (34.54 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of LSM6 expression in transfected 293T cell line by LSM6 monoclonal antibody (M01), clone 4B5-1B10. Lane 1: LSM6 transfected lysate(9.1 KDa). Lane 2: Non-transfected lysate. |
Applications: | IF,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |