Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PTP4A3 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about PTP4A3 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00011156-A01 |
| Product name: | PTP4A3 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a full-length recombinant PTP4A3. |
| Gene id: | 11156 |
| Gene name: | PTP4A3 |
| Gene alias: | PRL-3|PRL-R|PRL3 |
| Gene description: | protein tyrosine phosphatase type IVA, member 3 |
| Genbank accession: | BC003105 |
| Immunogen: | PTP4A3 (AAH03105, 1 a.a. ~ 148 a.a) full-length recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPFDDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRKRRGAINSKQLTYLEKYRPKQRLRFKDPHTHKTRCCVM |
| Protein accession: | AAH03105 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (42.39 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | 8q24 amplification is associated with Myc expression and prostate cancer progression and is an independent predictor of recurrence after radical prostatectomy.Fromont G, Godet J, Peyret A, Irani J, Celhay O, Rozet F, Cathelineau X, Cussenot O Hum Pathol. 2013 Apr 8. pii: S0046-8177(13)00045-2. doi: 10.1016/j.humpath.2013.01.012. |