CORO1A monoclonal antibody (M03), clone 1A8 View larger

CORO1A monoclonal antibody (M03), clone 1A8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CORO1A monoclonal antibody (M03), clone 1A8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about CORO1A monoclonal antibody (M03), clone 1A8

Brand: Abnova
Reference: H00011151-M03
Product name: CORO1A monoclonal antibody (M03), clone 1A8
Product description: Mouse monoclonal antibody raised against a partial recombinant CORO1A.
Clone: 1A8
Isotype: IgG2a Kappa
Gene id: 11151
Gene name: CORO1A
Gene alias: CLABP|CLIPINA|FLJ41407|HCORO1|MGC117380|TACO|p57
Gene description: coronin, actin binding protein, 1A
Genbank accession: NM_007074
Immunogen: CORO1A (NP_009005, 360 a.a. ~ 461 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: QEDLYPPTAGPDPALTAEEWLGGRDAGPLLISLKDGYVPPKSRELRVNRGLDTGRRRAAPEASGTPSSDAVSRLEEEMRKLQATVQELQKRLDRLEETVQAK
Protein accession: NP_009005
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00011151-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.96 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CORO1A monoclonal antibody (M03), clone 1A8 now

Add to cart