HHLA3 monoclonal antibody (M01), clone 1F6 View larger

HHLA3 monoclonal antibody (M01), clone 1F6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HHLA3 monoclonal antibody (M01), clone 1F6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about HHLA3 monoclonal antibody (M01), clone 1F6

Brand: Abnova
Reference: H00011147-M01
Product name: HHLA3 monoclonal antibody (M01), clone 1F6
Product description: Mouse monoclonal antibody raised against a partial recombinant HHLA3.
Clone: 1F6
Isotype: IgG2a Kappa
Gene id: 11147
Gene name: HHLA3
Gene alias: -
Gene description: HERV-H LTR-associating 3
Genbank accession: NM_007071
Immunogen: HHLA3 (NP_009002, 1 a.a. ~ 53 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MFGACYKQPLKPSGSEPPAEECRMTPRHAGCDVTEMQRILSQPTFTEHLLRAV
Protein accession: NP_009002
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00011147-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (31.57 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00011147-M01-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to HHLA3 on HeLa cell . [antibody concentration 10 ug/ml]
Applications: IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy HHLA3 monoclonal antibody (M01), clone 1F6 now

Add to cart