GLMN monoclonal antibody (M01), clone 1C12 View larger

GLMN monoclonal antibody (M01), clone 1C12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GLMN monoclonal antibody (M01), clone 1C12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr,IP

More info about GLMN monoclonal antibody (M01), clone 1C12

Brand: Abnova
Reference: H00011146-M01
Product name: GLMN monoclonal antibody (M01), clone 1C12
Product description: Mouse monoclonal antibody raised against a full length recombinant GLMN.
Clone: 1C12
Isotype: IgG1 Kappa
Gene id: 11146
Gene name: GLMN
Gene alias: FAP|FAP48|FAP68|FKBPAP|GLML|GVM|VMGLOM
Gene description: glomulin, FKBP associated protein
Genbank accession: BC001257
Immunogen: GLMN (AAH01257, 1 a.a. ~ 594 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAVEELQSIIKRCQILEEQDFKEEDFGLFQLAGQRCIEEGHTDQLLEIIQNEKNKVIIKNMGWNLVGPVVRCLLCKDKEDSKRKVYFLIFDLLVKLCNPKELLLGLLELIEEPSGKQISQSILLLLQPLQTVIQKLHNKAYSIGLALSTLWNQLSLLPVPYSKEQIQMDDYGLCQCCKALIEFTKPFVEEVIDNKENSLENEKLKDELLKFCFKSLKCPLLTAQFFEQSEEGGNDPFRYFASEIIGFLSAIGHPFPKMIFNHGRKKRTWNYLEFEEEENKQLADSMASLAYLVFVQGIHIDQLPMVLSPLYLLQFNMGHIEVFLQRTEESVISKGLELLENSLLRIEDNSLLYQYLEIKSFLTVPQGLVKVMTLCPIETLRKKSLAMLQLYINKLDSQGKYTLFRCLLNTSNHSGVEAFIIQNIKNQIDMSLKRTRNNKWFTGPQLISLLDLVLFLPEGAETDLLQNSDRIMASLNLLRYLVIKDNENDNQTGLWTELGNIENNFLKPLHIGLNMSKAHYEAEIKNSQEAQKSKDLCSITVSGEEIPNMPPEMQLKVLHSALFTFDLIESVLARVEELIEIKTKSTSEENIGIK
Protein accession: AAH01257
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00011146-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (91.08 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00011146-M01-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to GLMN on HeLa cell. [antibody concentration 20 ug/ml]
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy GLMN monoclonal antibody (M01), clone 1C12 now

Add to cart