HRASLS3 monoclonal antibody (M01), clone 1B10-2D9 View larger

HRASLS3 monoclonal antibody (M01), clone 1B10-2D9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HRASLS3 monoclonal antibody (M01), clone 1B10-2D9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about HRASLS3 monoclonal antibody (M01), clone 1B10-2D9

Brand: Abnova
Reference: H00011145-M01
Product name: HRASLS3 monoclonal antibody (M01), clone 1B10-2D9
Product description: Mouse monoclonal antibody raised against a full length recombinant HRASLS3.
Clone: 1B10-2D9
Isotype: IgG1 kappa
Gene id: 11145
Gene name: PLA2G16
Gene alias: AdPLA|H-REV107-1|HRASLS3|HREV107|HREV107-3|MGC118754
Gene description: phospholipase A2, group XVI
Genbank accession: BC001387
Immunogen: HRASLS3 (AAH01387, 1 a.a. ~ 162 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MRAPIPEPKPGDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIVKKELLYDVAGSDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRDVIIAASVAGMGLAAMSLIGVMFSRNKRQKQ
Protein accession: AAH01387
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00011145-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (43.56 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: http://www.abnova.com/application_image/
Application image note: Detection limit for recombinant GST tagged HRASLS3 is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy HRASLS3 monoclonal antibody (M01), clone 1B10-2D9 now

Add to cart