Cart 132 Product Products 51 074,48 € (empty)
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x Cleaved-Ca...259,07 € -
-
-
-
-
-
-
-
1 x Galectin-3...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
No products
To be determined Shipping
51 074,48 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 132 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 51 074,48 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 51 074,48 €
Data sheet of HRASLS3 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Rabbit |
| Applications | WB-Ce,IF,WB-Tr |
More info about HRASLS3 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand: | Abnova |
| Reference: | H00011145-D01P |
| Product name: | HRASLS3 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human HRASLS3 protein. |
| Gene id: | 11145 |
| Gene name: | PLA2G16 |
| Gene alias: | AdPLA|H-REV107-1|HRASLS3|HREV107|HREV107-3|MGC118754 |
| Gene description: | phospholipase A2, group XVI |
| Genbank accession: | BC001387 |
| Immunogen: | HRASLS3 (AAH01387.1, 1 a.a. ~ 162 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MRAPIPEPKPGDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIVKKELLYDVAGSDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRDVIIAASVAGMGLAAMSLIGVMFSRNKRQKQ |
| Protein accession: | AAH01387.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | Western Blot analysis of PLA2G16 expression in transfected 293T cell line (H00011145-T02) by PLA2G16 MaxPab polyclonal antibody. Lane 1: HRASLS3 transfected lysate(17.90 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ce,IF,WB-Tr |
| Shipping condition: | Dry Ice |