DMC1 (Human) Recombinant Protein (Q01) View larger

DMC1 (Human) Recombinant Protein (Q01)

H00011144-Q01_25ug

New product

374,00 € tax excl.

25 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DMC1 (Human) Recombinant Protein (Q01)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about DMC1 (Human) Recombinant Protein (Q01)

Brand: Abnova
Reference: H00011144-Q01
Product name: DMC1 (Human) Recombinant Protein (Q01)
Product description: Human DMC1 partial ORF ( NP_008999, 237 a.a. - 339 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 11144
Gene name: DMC1
Gene alias: DMC1H|HsLim15|LIM15|MGC150472|MGC150473|dJ199H16.1
Gene description: DMC1 dosage suppressor of mck1 homolog, meiosis-specific homologous recombination (yeast)
Genbank accession: NM_007068
Immunogen sequence/protein sequence: GELAERQQKLAQMLSRLQKISEEYNVAVFVTNQMTADPGATMTFQADPKKPIGGHILAHASTTRISLRKGRGELRIAKIYDSPEMPENEATFAITAGGIGDAK
Protein accession: NP_008999
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00011144-Q01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy DMC1 (Human) Recombinant Protein (Q01) now

Add to cart