DMC1 monoclonal antibody (M10), clone 4A10 View larger

DMC1 monoclonal antibody (M10), clone 4A10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DMC1 monoclonal antibody (M10), clone 4A10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Rat
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re

More info about DMC1 monoclonal antibody (M10), clone 4A10

Brand: Abnova
Reference: H00011144-M10
Product name: DMC1 monoclonal antibody (M10), clone 4A10
Product description: Mouse monoclonal antibody raised against a partial recombinant DMC1.
Clone: 4A10
Isotype: IgG2a Kappa
Gene id: 11144
Gene name: DMC1
Gene alias: DMC1H|HsLim15|LIM15|MGC150472|MGC150473|dJ199H16.1
Gene description: DMC1 dosage suppressor of mck1 homolog, meiosis-specific homologous recombination (yeast)
Genbank accession: NM_007068
Immunogen: DMC1 (NP_008999, 237 a.a. ~ 339 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GELAERQQKLAQMLSRLQKISEEYNVAVFVTNQMTADPGATMTFQADPKKPIGGHILAHASTTRISLRKGRGELRIAKIYDSPEMPENEATFAITAGGIGDAK
Protein accession: NP_008999
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00011144-M10-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.07 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Rat
Application image: H00011144-M10-1-25-1.jpg
Application image note: DMC1 monoclonal antibody (M10), clone 4A10. Western Blot analysis of DMC1 expression in Hela S3 NE(Cat # L013V3 ).
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy DMC1 monoclonal antibody (M10), clone 4A10 now

Add to cart