Brand: | Abnova |
Reference: | H00011144-A01 |
Product name: | DMC1 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant DMC1. |
Gene id: | 11144 |
Gene name: | DMC1 |
Gene alias: | DMC1H|HsLim15|LIM15|MGC150472|MGC150473|dJ199H16.1 |
Gene description: | DMC1 dosage suppressor of mck1 homolog, meiosis-specific homologous recombination (yeast) |
Genbank accession: | NM_007068 |
Immunogen: | DMC1 (NP_008999, 237 a.a. ~ 339 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | GELAERQQKLAQMLSRLQKISEEYNVAVFVTNQMTADPGATMTFQADPKKPIGGHILAHASTTRISLRKGRGELRIAKIYDSPEMPENEATFAITAGGIGDAK |
Protein accession: | NP_008999 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.44 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |