IL1RAPL1 monoclonal antibody (M04), clone 1C10 View larger

IL1RAPL1 monoclonal antibody (M04), clone 1C10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IL1RAPL1 monoclonal antibody (M04), clone 1C10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about IL1RAPL1 monoclonal antibody (M04), clone 1C10

Brand: Abnova
Reference: H00011141-M04
Product name: IL1RAPL1 monoclonal antibody (M04), clone 1C10
Product description: Mouse monoclonal antibody raised against a partial recombinant IL1RAPL1.
Clone: 1C10
Isotype: IgG2a Kappa
Gene id: 11141
Gene name: IL1RAPL1
Gene alias: IL1R8|IL1RAPL|MRX10|MRX21|MRX34|OPHN4|TIGIRR-2
Gene description: interleukin 1 receptor accessory protein-like 1
Genbank accession: NM_014271
Immunogen: IL1RAPL1 (NP_055086.1, 151 a.a. ~ 250 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: FEKAELSKSKEISCRDIEDFLLPTREPEILWYKECRTKTWRPSIVFKRDTLLIREVREDDIGNYTCELKYGGFVVRRTTELTVTAPLTDKPPKLLYPMES
Protein accession: NP_055086.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00011141-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00011141-M04-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged IL1RAPL1 is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Mutations in the calcium-related gene IL1RAPL1 are associated with autism.Piton A, Michaud JL, Peng H, Aradhya S, Gauthier J, Mottron L, Champagne N, Lafreniere RG, Hamdan FF; S2D team, Joober R, Fombonne E, Marineau C, Cossette P, Dube MP, Haghighi P, Drapeau P, Barker PA, Carbonetto S, Rouleau GA.
Hum Mol Genet. 2008 Dec 15;17(24):3965-74. Epub 2008 Sep 18.

Reviews

Buy IL1RAPL1 monoclonal antibody (M04), clone 1C10 now

Add to cart