TBC1D8 monoclonal antibody (M02), clone 1A12 View larger

TBC1D8 monoclonal antibody (M02), clone 1A12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TBC1D8 monoclonal antibody (M02), clone 1A12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re

More info about TBC1D8 monoclonal antibody (M02), clone 1A12

Brand: Abnova
Reference: H00011138-M02
Product name: TBC1D8 monoclonal antibody (M02), clone 1A12
Product description: Mouse monoclonal antibody raised against a partial recombinant TBC1D8.
Clone: 1A12
Isotype: IgG2a Kappa
Gene id: 11138
Gene name: TBC1D8
Gene alias: AD3|HBLP1|VRP
Gene description: TBC1 domain family, member 8 (with GRAM domain)
Genbank accession: NM_007063
Immunogen: TBC1D8 (NP_008994, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MEQLADVTLRRLLDNEVFDLDPDLQEPSQITKRDLEARAQNEFFRAFFRLPRKEKLHAVVDCSLWTPFSRCHTAGRMFASDSYICFASREDGCCKIILPLREVVSIEKME
Protein accession: NP_008994
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00011138-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00011138-M02-1-9-1.jpg
Application image note: TBC1D8 monoclonal antibody (M02), clone 1A12 Western Blot analysis of TBC1D8 expression in K-562 ( Cat # L009V1 ).
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TBC1D8 monoclonal antibody (M02), clone 1A12 now

Add to cart