Brand: | Abnova |
Reference: | H00011138-M02 |
Product name: | TBC1D8 monoclonal antibody (M02), clone 1A12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TBC1D8. |
Clone: | 1A12 |
Isotype: | IgG2a Kappa |
Gene id: | 11138 |
Gene name: | TBC1D8 |
Gene alias: | AD3|HBLP1|VRP |
Gene description: | TBC1 domain family, member 8 (with GRAM domain) |
Genbank accession: | NM_007063 |
Immunogen: | TBC1D8 (NP_008994, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MEQLADVTLRRLLDNEVFDLDPDLQEPSQITKRDLEARAQNEFFRAFFRLPRKEKLHAVVDCSLWTPFSRCHTAGRMFASDSYICFASREDGCCKIILPLREVVSIEKME |
Protein accession: | NP_008994 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | TBC1D8 monoclonal antibody (M02), clone 1A12 Western Blot analysis of TBC1D8 expression in K-562 ( Cat # L009V1 ). |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |