CDC42EP1 monoclonal antibody (M01), clone 3A4 View larger

CDC42EP1 monoclonal antibody (M01), clone 3A4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CDC42EP1 monoclonal antibody (M01), clone 3A4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about CDC42EP1 monoclonal antibody (M01), clone 3A4

Brand: Abnova
Reference: H00011135-M01
Product name: CDC42EP1 monoclonal antibody (M01), clone 3A4
Product description: Mouse monoclonal antibody raised against a full length recombinant CDC42EP1.
Clone: 3A4
Isotype: IgG1 Kappa
Gene id: 11135
Gene name: CDC42EP1
Gene alias: BORG5|CEP1|MGC15316|MSE55
Gene description: CDC42 effector protein (Rho GTPase binding) 1
Genbank accession: BC009356
Immunogen: CDC42EP1 (AAH09356, 1 a.a. ~ 384 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MPGPQGGRGAATMSLGKLSPVGWVSSSQGKRRLTADMISHPLGDFRHTMHVGRGGDVFGDTSFLSNHGGSSGSTHRSPRSFLAKKLQLVRRVGAPPRRMASPPAPSPAPPAISPIIKNAISLPQLNQAAYDSLVVGKLSFDSSPTSSTDGHSSYGLDSGFCTISRLPRSEKPHDRDRDGSFPSEPGLRRSDSLLSFRLDLDLGPSLLSELLGVMSLPEAPAAETPAPAANPPAPTANPTGPAANPPATTANPPAPAATPTGPAANPPAPAASSTPHGHCPNGVTAGLGPVAEVKSSPVGGGPRGPAGPALGRHWGAGWDGGHHYPEMDARQERVEVLPQARASWESLDEEWRAPQAGSRTPVPSTVQANTFEFADAEEDDEVKV
Protein accession: AAH09356
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00011135-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (67.98 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CDC42EP1 monoclonal antibody (M01), clone 3A4 now

Add to cart