FAF1 monoclonal antibody (M01), clone 1A10 View larger

FAF1 monoclonal antibody (M01), clone 1A10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FAF1 monoclonal antibody (M01), clone 1A10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re

More info about FAF1 monoclonal antibody (M01), clone 1A10

Brand: Abnova
Reference: H00011124-M01
Product name: FAF1 monoclonal antibody (M01), clone 1A10
Product description: Mouse monoclonal antibody raised against a partial recombinant FAF1.
Clone: 1A10
Isotype: IgG1 Kappa
Gene id: 11124
Gene name: FAF1
Gene alias: CGI-03|FLJ37524|HFAF1s|UBXD12|UBXN3A|hFAF1
Gene description: Fas (TNFRSF6) associated factor 1
Genbank accession: NM_007051
Immunogen: FAF1 (NP_008982, 551 a.a. ~ 650 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EAIRLSLEQALPPEPKEENAEPVSKLRIRTPSGEFLERRFLASNKLQIVFDFVASKGFPWDEYKLLSTFPRRDVTQLDPNKSLLEVKLFPQETLFLEAKE
Protein accession: NP_008982
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00011124-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00011124-M01-1-1-1.jpg
Application image note: FAF1 monoclonal antibody (M01), clone 1A10 Western Blot analysis of FAF1 expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy FAF1 monoclonal antibody (M01), clone 1A10 now

Add to cart