Brand: | Abnova |
Reference: | H00011124-M01 |
Product name: | FAF1 monoclonal antibody (M01), clone 1A10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant FAF1. |
Clone: | 1A10 |
Isotype: | IgG1 Kappa |
Gene id: | 11124 |
Gene name: | FAF1 |
Gene alias: | CGI-03|FLJ37524|HFAF1s|UBXD12|UBXN3A|hFAF1 |
Gene description: | Fas (TNFRSF6) associated factor 1 |
Genbank accession: | NM_007051 |
Immunogen: | FAF1 (NP_008982, 551 a.a. ~ 650 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | EAIRLSLEQALPPEPKEENAEPVSKLRIRTPSGEFLERRFLASNKLQIVFDFVASKGFPWDEYKLLSTFPRRDVTQLDPNKSLLEVKLFPQETLFLEAKE |
Protein accession: | NP_008982 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | FAF1 monoclonal antibody (M01), clone 1A10 Western Blot analysis of FAF1 expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |