Brand: | Abnova |
Reference: | H00011120-M01 |
Product name: | BTN2A1 monoclonal antibody (M01), clone 3A1 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant BTN2A1. |
Clone: | 3A1 |
Isotype: | IgG2a Kappa |
Gene id: | 11120 |
Gene name: | BTN2A1 |
Gene alias: | BK14H9.1|BT2.1|BTF1|DJ3E1.1|FLJ36567 |
Gene description: | butyrophilin, subfamily 2, member A1 |
Genbank accession: | BC016661 |
Immunogen: | BTN2A1 (AAH16661, 1 a.a. ~ 334 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MESAAALHFSRPASLLLLLLSLCALVSAQFIVVGPTDPILATVGENTTLRCHLSPEKNAEDMEVRWFRSQFSPAVFVYKGGRERTEEQMEEYRGRTTFVSKDISRGSVALVIHNITAQENGTYRCYFQEGRSYDEAILHLVVAGLGSKPLISMRGHEDGGIRLECISRGWYPKPLTVWRDPYGGVAPALKEVSMPDADGLFMVTTAVIIRDKSVRNMSCSINNTLLGQKKESVIFIPESFMPSVSPCAVALPIIVVILMIPIAVCIYWINKLQKEKKILSGEKEFERETREIALKELEKERVQKEEELQVKEKLQEELRWRRTFLHAELQFFSN |
Protein accession: | AAH16661 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged BTN2A1 is approximately 1ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |