BTN2A1 monoclonal antibody (M01), clone 3A1 View larger

BTN2A1 monoclonal antibody (M01), clone 3A1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BTN2A1 monoclonal antibody (M01), clone 3A1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about BTN2A1 monoclonal antibody (M01), clone 3A1

Brand: Abnova
Reference: H00011120-M01
Product name: BTN2A1 monoclonal antibody (M01), clone 3A1
Product description: Mouse monoclonal antibody raised against a full length recombinant BTN2A1.
Clone: 3A1
Isotype: IgG2a Kappa
Gene id: 11120
Gene name: BTN2A1
Gene alias: BK14H9.1|BT2.1|BTF1|DJ3E1.1|FLJ36567
Gene description: butyrophilin, subfamily 2, member A1
Genbank accession: BC016661
Immunogen: BTN2A1 (AAH16661, 1 a.a. ~ 334 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MESAAALHFSRPASLLLLLLSLCALVSAQFIVVGPTDPILATVGENTTLRCHLSPEKNAEDMEVRWFRSQFSPAVFVYKGGRERTEEQMEEYRGRTTFVSKDISRGSVALVIHNITAQENGTYRCYFQEGRSYDEAILHLVVAGLGSKPLISMRGHEDGGIRLECISRGWYPKPLTVWRDPYGGVAPALKEVSMPDADGLFMVTTAVIIRDKSVRNMSCSINNTLLGQKKESVIFIPESFMPSVSPCAVALPIIVVILMIPIAVCIYWINKLQKEKKILSGEKEFERETREIALKELEKERVQKEEELQVKEKLQEELRWRRTFLHAELQFFSN
Protein accession: AAH16661
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00011120-M01-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged BTN2A1 is approximately 1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy BTN2A1 monoclonal antibody (M01), clone 3A1 now

Add to cart