FGFR1OP monoclonal antibody (M02), clone 1E8 View larger

FGFR1OP monoclonal antibody (M02), clone 1E8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FGFR1OP monoclonal antibody (M02), clone 1E8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about FGFR1OP monoclonal antibody (M02), clone 1E8

Brand: Abnova
Reference: H00011116-M02
Product name: FGFR1OP monoclonal antibody (M02), clone 1E8
Product description: Mouse monoclonal antibody raised against a full-length recombinant FGFR1OP.
Clone: 1E8
Isotype: IgG1 Kappa
Gene id: 11116
Gene name: FGFR1OP
Gene alias: FOP
Gene description: FGFR1 oncogene partner
Genbank accession: BC011902
Immunogen: FGFR1OP (AAH11902, 1 a.a. ~ 379 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAATAAAVVAEEDTELRDLLVQTLENSGVLNRIKAELRAAVFLALEEQEKVENKTPLVNESLRKFLNTKDGRLVASLVAEFLQFFNLDFTLAVFQPETSTLQGLEGRENLARDLGIIEAEGTVGGPLLLEVIRRCQQKEKGPTTGEGALDLSDVHSPPKSPEGKTSAQTTPSKKANDEANQSDTSVSLSEPKSKSSLHLLSHETKIGSFLSNRTLDGKDKAGLCPDEDDMEGDSFFDDPIPKPEKTYGLRNEPRKQAGSLASLSDAPPLKSGLSSLAGAPSLKDSESKRGNTVLKDLKLISDKIGSLGLGTGEDDDYVDDFNSTSHRSEKSEISIGEEIEEDLSVEIDDINTSDKLDDLTQDLTVSQLSDVADYLEDVA
Protein accession: AAH11902
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00011116-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (67.43 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00011116-M02-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged FGFR1OP is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy FGFR1OP monoclonal antibody (M02), clone 1E8 now

Add to cart