FGFR1OP monoclonal antibody (M01), clone 2B1 View larger

FGFR1OP monoclonal antibody (M01), clone 2B1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FGFR1OP monoclonal antibody (M01), clone 2B1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re,WB-Tr

More info about FGFR1OP monoclonal antibody (M01), clone 2B1

Brand: Abnova
Reference: H00011116-M01
Product name: FGFR1OP monoclonal antibody (M01), clone 2B1
Product description: Mouse monoclonal antibody raised against a full length recombinant FGFR1OP.
Clone: 2B1
Isotype: IgG2b kappa
Gene id: 11116
Gene name: FGFR1OP
Gene alias: FOP
Gene description: FGFR1 oncogene partner
Genbank accession: BC011902
Immunogen: FGFR1OP (AAH11902, 1 a.a. ~ 379 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAATAAAVVAEEDTELRDLLVQTLENSGVLNRIKAELRAAVFLALEEQEKVENKTPLVNESLRKFLNTKDGRLVASLVAEFLQFFNLDFTLAVFQPETSTLQGLEGRENLARDLGIIEAEGTVGGPLLLEVIRRCQQKEKGPTTGEGALDLSDVHSPPKSPEGKTSAQTTPSKKANDEANQSDTSVSLSEPKSKSSLHLLSHETKIGSFLSNRTLDGKDKAGLCPDEDDMEGDSFFDDPIPKPEKTYGLRNEPRKQAGSLASLSDAPPLKSGLSSLAGAPSLKDSESKRGNTVLKDLKLISDKIGSLGLGTGEDDDYVDDFNSTSHRSEKSEISIGEEIEEDLSVEIDDINTSDKLDDLTQDLTVSQLSDVADYLEDVA
Protein accession: AAH11902
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00011116-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (67.43 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00011116-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged FGFR1OP is approximately 0.03ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice
Publications: Fibroblast growth factor receptor 1 oncogene partner as a novel prognostic biomarker and therapeutic target for lung cancer.Mano Y, Takahashi K, Ishikawa N, Takano A, Yasui W, Inai K, Nishimura H, Tsuchiya E, Nakamura Y, Daigo Y.
Cancer Sci. 2007 Dec;98(12):1902-13. Epub 2007 Sep 18.

Reviews

Buy FGFR1OP monoclonal antibody (M01), clone 2B1 now

Add to cart