PRDM4 monoclonal antibody (M04), clone 3E3 View larger

PRDM4 monoclonal antibody (M04), clone 3E3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PRDM4 monoclonal antibody (M04), clone 3E3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,IF,ELISA,WB-Re

More info about PRDM4 monoclonal antibody (M04), clone 3E3

Brand: Abnova
Reference: H00011108-M04
Product name: PRDM4 monoclonal antibody (M04), clone 3E3
Product description: Mouse monoclonal antibody raised against a partial recombinant PRDM4.
Clone: 3E3
Isotype: IgG2b Kappa
Gene id: 11108
Gene name: PRDM4
Gene alias: MGC45046|PFM1
Gene description: PR domain containing 4
Genbank accession: NM_012406
Immunogen: PRDM4 (NP_036538, 476 a.a. ~ 575 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: IITTDENECNWMMFVRKARNREEQNLVAYPHDGKIFFCTSQDIPPENELLFYYSRDYAQQIGVPEHPDVHLCNCGKECNSYTEFKAHLTSHIHNHLPTQG
Protein accession: NP_036538
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00011108-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00011108-M04-3-2-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to PRDM4 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 1.5 ug/ml]
Applications: IHC-P,IF,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PRDM4 monoclonal antibody (M04), clone 3E3 now

Add to cart