PRDM4 monoclonal antibody (M03), clone 4H7 View larger

PRDM4 monoclonal antibody (M03), clone 4H7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PRDM4 monoclonal antibody (M03), clone 4H7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about PRDM4 monoclonal antibody (M03), clone 4H7

Brand: Abnova
Reference: H00011108-M03
Product name: PRDM4 monoclonal antibody (M03), clone 4H7
Product description: Mouse monoclonal antibody raised against a partial recombinant PRDM4.
Clone: 4H7
Isotype: IgG2a Kappa
Gene id: 11108
Gene name: PRDM4
Gene alias: MGC45046|PFM1
Gene description: PR domain containing 4
Genbank accession: NM_012406
Immunogen: PRDM4 (NP_036538, 476 a.a. ~ 575 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: IITTDENECNWMMFVRKARNREEQNLVAYPHDGKIFFCTSQDIPPENELLFYYSRDYAQQIGVPEHPDVHLCNCGKECNSYTEFKAHLTSHIHNHLPTQG
Protein accession: NP_036538
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00011108-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00011108-M03-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged PRDM4 is 3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PRDM4 monoclonal antibody (M03), clone 4H7 now

Add to cart