PRDM4 monoclonal antibody (M02), clone 2C11 View larger

PRDM4 monoclonal antibody (M02), clone 2C11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PRDM4 monoclonal antibody (M02), clone 2C11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,ELISA

More info about PRDM4 monoclonal antibody (M02), clone 2C11

Brand: Abnova
Reference: H00011108-M02
Product name: PRDM4 monoclonal antibody (M02), clone 2C11
Product description: Mouse monoclonal antibody raised against a partial recombinant PRDM4.
Clone: 2C11
Isotype: IgG2b Kappa
Gene id: 11108
Gene name: PRDM4
Gene alias: MGC45046|PFM1
Gene description: PR domain containing 4
Genbank accession: NM_012406
Immunogen: PRDM4 (NP_036538, 476 a.a. ~ 575 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: IITTDENECNWMMFVRKARNREEQNLVAYPHDGKIFFCTSQDIPPENELLFYYSRDYAQQIGVPEHPDVHLCNCGKECNSYTEFKAHLTSHIHNHLPTQG
Protein accession: NP_036538
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00011108-M02-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to PRDM4 on HeLa cell . [antibody concentration 10 ug/ml]
Applications: IF,ELISA
Shipping condition: Dry Ice

Reviews

Buy PRDM4 monoclonal antibody (M02), clone 2C11 now

Add to cart