RPP14 monoclonal antibody (M01A), clone 3H4 View larger

RPP14 monoclonal antibody (M01A), clone 3H4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RPP14 monoclonal antibody (M01A), clone 3H4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about RPP14 monoclonal antibody (M01A), clone 3H4

Brand: Abnova
Reference: H00011102-M01A
Product name: RPP14 monoclonal antibody (M01A), clone 3H4
Product description: Mouse monoclonal antibody raised against a partial recombinant RPP14.
Clone: 3H4
Isotype: IgG2a Kappa
Gene id: 11102
Gene name: RPP14
Gene alias: FLJ31508|P14
Gene description: ribonuclease P/MRP 14kDa subunit
Genbank accession: NM_007042
Immunogen: RPP14 (NP_008973, 1 a.a. ~ 75 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MPAPAATYERVVYKNPSEYHYMKVCLEFQDCGVGLNAAQFKQLLISAVKDLFGEVDAALPLDILTYEEKTLSAIL
Protein accession: NP_008973
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00011102-M01A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (33.99 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00011102-M01A-13-15-1.jpg
Application image note: Western Blot analysis of RPP14 expression in transfected 293T cell line by RPP14 monoclonal antibody (M01A), clone 3H4.

Lane 1: RPP14 transfected lysate (Predicted MW: 13.7 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy RPP14 monoclonal antibody (M01A), clone 3H4 now

Add to cart