ATE1 monoclonal antibody (M01), clone 2B6 View larger

ATE1 monoclonal antibody (M01), clone 2B6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ATE1 monoclonal antibody (M01), clone 2B6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr

More info about ATE1 monoclonal antibody (M01), clone 2B6

Brand: Abnova
Reference: H00011101-M01
Product name: ATE1 monoclonal antibody (M01), clone 2B6
Product description: Mouse monoclonal antibody raised against a partial recombinant ATE1.
Clone: 2B6
Isotype: IgG2b Kappa
Gene id: 11101
Gene name: ATE1
Gene alias: MGC26724
Gene description: arginyltransferase 1
Genbank accession: NM_001001976
Immunogen: ATE1 (NP_001001976, 1 a.a. ~ 87 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAFWAGGSPSVVDYFPSEDFYRCGYCKNESGSRSNGMWAHSMTVQDYQDLIDRGWRRSGKYVYKPVMNQTCCPQYTIRCRPLQFQPS
Protein accession: NP_001001976
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00011101-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.2 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00011101-M01-1-6-1.jpg
Application image note: ATE1 monoclonal antibody (M01), clone 2B6. Western Blot analysis of ATE1 expression in Jurkat(Cat # L017V1 ).
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ATE1 monoclonal antibody (M01), clone 2B6 now

Add to cart